PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn214321
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 300aa    MW: 34431.4 Da    PI: 8.5939
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn214321genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.51.1e-3167120255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 prlrWtp+LH +F++a+e+LGG+e+AtPk ++++m+vkgLt++hvkSHLQ+YR+
  Achn214321  67 PRLRWTPDLHLCFLQAIERLGGQERATPKLVVQVMNVKGLTIAHVKSHLQMYRS 120
                 8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-2963121IPR009057Homeodomain-like
PROSITE profilePS5129413.19663123IPR017930Myb domain
SuperFamilySSF466895.2E-1565121IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-2467122IPR006447Myb domain, plants
PfamPF002493.8E-868119IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MKEIGDIEVS KSHPLDMNIE DHEEGCDDHD DEDKPKTSAS SSNSVDEDGE KKVTSSGVRK  60
YIRSKVPRLR WTPDLHLCFL QAIERLGGQE RATPKLVVQV MNVKGLTIAH VKSHLQMYRS  120
KKIDSQGQVI NGRRYAIGRA DGFVDNFWQP FVLHHKLRPY NDVPWSDHKN WISSSCIADN  180
MNGAFYADHR KRSYESHYQH SRQWHGNGVE NVNYFFNNSF IPNSSWSTNR GQKCRTLKRR  240
AQDNDLIDLN PSLSVKKSRQ EEVKKTTWDD EVDSDLSLSL FSRAKKQNLA IDLNFPSIS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002313237.28e-70hypothetical protein POPTR_0009s07890g, partial
TrEMBLB9HNC08e-70B9HNC0_POPTR; Uncharacterized protein (Fragment)
STRINGPOPTR_0009s07890.12e-69(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43822141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-41G2-like family protein